Apache OpenOffice (AOO) Bugzilla – Full Text Issue Listing |
Summary: | SegFault when replacing with regular expression in a selection | ||
---|---|---|---|
Product: | Writer | Reporter: | bkleine <bbfk> |
Component: | code | Assignee: | writerneedsconfirm <swneedsconfirm> |
Status: | CLOSED IRREPRODUCIBLE | QA Contact: | |
Severity: | Blocker | ||
Priority: | P5 (lowest) | CC: | hdu, issues |
Version: | OOo 3.3 | Keywords: | crash, usability |
Target Milestone: | --- | ||
Hardware: | PC | ||
OS: | Linux, all | ||
Issue Type: | DEFECT | Latest Confirmation in: | --- |
Developer Difficulty: | --- |
Description
bkleine
2011-10-01 11:00:03 UTC
Hi, I have some protein sequence date where I want to add ";" to be able to make tables. using reg expressions in search/replace and choosing "." in search and "$0;" in replace works as long as I donot select the data before doing search and replace. When I have the data selected, doing the same search/replace action first of all the entire first line is replace and not the first letter, and after that the programm has crashed. Steps to repeat: Use: mrkrapqsemapagvslratilcllawaglaagDRVYIHPFHLvihnest ceqlakanagkpkdptfipapiqaktspvdekalqdqlvlvaakldtedk lraamvgmlanflgfriygmhselwgvvhgatvlsptavfgtlaslylga ldhtadrlqailgvpwkdknctsrldahkvlsalqavqgllvaqgradsq Search (with reg.expr selected) "." replace $0; Then select the text and repeat the search replace. Greeting Bernhard bug #56449 and #50510 are in the same drawer Bernhard Not reproducible with the new ICU based regexp engine available in recent Apache OpenOffice builds available at http://s.apache.org/Jqc. While looking into this bug #118862 has been found (for single replacement). Not reproducible on Apache OpenOffice. AOO34 development builds are available at http://s.apache.org/Jqc |