Apache OpenOffice (AOO) Bugzilla – Issue 118475
SegFault when replacing with regular expression in a selection
Last modified: 2012-02-07 20:37:10 UTC
Hi, I have some protein sequence date where I want to add ";" to be able to make tables. using reg expressions in search/replace and choosing "." in search and "$0;" in replace works as long as I donot select the data before doing search and replace. When I have the data selected, doing the same search/replace action first of all the entire first line is replace and not the first letter, and after that the programm has crashed. Steps to repeat: Use: mrkrapqsemapagvslratilcllawaglaagDRVYIHPFHLvihnest ceqlakanagkpkdptfipapiqaktspvdekalqdqlvlvaakldtedk lraamvgmlanflgfriygmhselwgvvhgatvlsptavfgtlaslylga ldhtadrlqailgvpwkdknctsrldahkvlsalqavqgllvaqgradsq Search (with reg.expr selected) "." replace $0; Then select the text and repeat the search replace. Greeting Bernhard
bug #56449 and #50510 are in the same drawer Bernhard
Not reproducible with the new ICU based regexp engine available in recent Apache OpenOffice builds available at http://s.apache.org/Jqc. While looking into this bug #118862 has been found (for single replacement).
Not reproducible on Apache OpenOffice. AOO34 development builds are available at http://s.apache.org/Jqc